ArtNr |
CJ28-1mg |
Hersteller |
Bon Opus
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Lyophilized |
Specific against |
Human |
Host |
Human |
Konjugat/Tag |
His |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Sequence |
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCS NPAVVFVTRKNRQVCANPEKKWVREYINSLEMSVD DIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWES NGQ |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
C-C Motif Chemokine 5, EoCP, Eosinophil Chemotactic Cytokine, SIS-Delta, Small-Inducible Cytokine A5, T Cell-Specific Protein P228, TCP228, T-Cell-Specific Protein RANTES, CCL5, D17S136E, SCYA5 |
Lieferbar |
|
Background |
Human Chemokine (C-C Motif) Ligand 5 (CCL5) plays an active role in recruiting leukocytes into inflammatory sites. CCL5 is secreted by many cell types at inflammatory sites & it exerts a wide range of activities through the receptors CCR1, CCR3, CCR4, & CCR5. N-Terminal truncated CCL5/RANTES, Met-RANTES, & amino-oxypentane (AOP)-RANTES exhibit antagonist or partial agonist functions on their receptors. CCL5/RANTES attracts different subtypes of leukocytes into inflamed tissue & intervenes in a wide range of allergic & autoimmune diseases. |
Description |
Recombinant Human C-C Motif Chemokine 5 is produced by our Mammalian expression system & the target gene encoding Ser24-Ser91 is expressed with a Fc, 6His tag at the C-terminus. |
Endotoxin |
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Formulation |
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4. |
Molecular Weight |
35, 8 |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Seq Length |
Ser24-Ser91 |
Ship Description |
The product is shipped at ambient temperature. |
Storage |
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.