« Zurück
Home /
[Novoprotein] Recombinant Human Nogo-A/Reticulon-4/RTN4 (N-GST)

[Novoprotein] Recombinant Human Nogo-A/Reticulon-4/RTN4 (N-GST)

ArtNr	CG56-1mg
Hersteller	Bon Opus
Menge	1mg
Kategorie	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Lyophilized
Specific against	Human
Host	E.coli
Konjugat/Tag	N-GST
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYER DEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMA IIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYG VSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHK TYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPK LVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATF GGGDHPPKSDLVPRGSMEDLDQSPLVSSSDSPPRP QPA
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Reticulon-4, Neuroendocrine-specific protein, Neuroendocrine-specific protein C homolog, Foocen, Neurite outgrowth inhibitor, RTN-x, NOGO & Reticulon-5.
Similar products	RTN4
Lieferbar
Background	RTN4 belongs to multiple-pass membrane peotein, which anchored to the membrane of the endoplasmic reticulum through 2 putative transmembrane domains. It acts as a developmental neurite growth regulatory factor with a roles as a negative regulator of axon-axon adhesion & growth. RTN4 regulates neurite fasciculation, branching & extension in the developing nervous system. It involved in down-regulation of growth, stabilization of wring & restriction of plasticity in the adult CNS. It regulates the radial migration of cortical neurons via an RTN4R-Lingo1 containing receptor complex.
Description	Recombinant Human Reticulon-4 is produced by our E.coli expression system & the target gene encoding Met1-Val185 is expressed with a GST tag at the N-terminus.
Endotoxin	Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Formulation	Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Molecular Weight	45, 5
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Seq Length	Met1-Val185
Ship Description	The product is shipped at ambient temperature.
Storage	Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen