ArtNr |
CE45-500ug |
Hersteller |
Bon Opus
|
Menge |
500ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Lyophilized |
Specific against |
Human |
Host |
E.coli |
Konjugat/Tag |
His |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Sequence |
MGSSHHHHHHSSGLVPRGSHMADVLSVLRQYNIQK KEIVVKGDEVIFGEFSWPKNVKTNYVVWGTGKEGQ PREYYTLDSILFLLNNVHLSHPVYVRRAATENIPV VRRPDRKDLLGYLNGEASTSASIDRSAPLEIGLQR STQVKRAADEVLAEAKKPRIEDEECVRLDKERLAA RLEGHKEGIVQTEQIRSLSEAMSVEKIAAIKAKIM AKKRSTIKTDLDDDITALKQRSFVDAEVDVTRDIV SRE |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Parafibromin, Cell Division Cycle Protein 73 Homolog, Hyperparathyroidism 2 Protein, CDC73, C1orf28, HRPT2 |
Similar products |
CDC73 |
Lieferbar |
|
Background |
Parafibromin is expressed in the adrenal & parathyroid glands, kidney, & heart. As a tumor supressor, Parafibromin may be involved in transcriptional & post-transcriptional control pathways, also through the regulation of cyclin D1/PRAD1 expression, involved the cell cycle progression. Parafibromin is a component of the the PAF protein complex & interacts with a Set1-like complex that has histone methyltransferase activity & methylates histone H3. Defects in Parafibromin can cause hyperparathyroidism-jaw tumor syndrome, familial isolated hyperparathyroidism, & parathyroid carcinoma. |
Description |
Recombinant Human CDC73 is produced by our E.coli expression system & the target gene encoding Met1-Glu260 is expressed with a 6His tag at the N-terminus. |
Endotoxin |
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Formulation |
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
Molecular Weight |
32, 77 |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Seq Length |
Met1-Glu260 |
Ship Description |
The product is shipped at ambient temperature. |
Storage |
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.