Vergleich

[Novoprotein] Recombinant Human Transforming Growth Factor a/TGFa

ArtNr C178-10ug
Hersteller Bon Opus
Menge 10ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against Human
Host E.coli
Konjugat/Tag None
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence VSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHS GYVGARCEHADLLAV
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Protransforming Growth Factor Alpha, TGF-Alpha, EGF-Like TGF, ETGF, TGF Type 1, TGFA
Similar products tgf-alpha
Lieferbar
Background
Transforming Growth Factor alpha (TGF-alpha) belongs to the EGF family of cytokines. It is a mitogenic polypeptide & secreted protein, which is expressed by monocytes, keratinocytes, & various tumor cells. TGFalpha contains two chains, protransforming growth factor alpha & transforming growth factor alpha. It can bind to the EGF receptor that synergistically with TGFbeta to stimulate anchorage-independent cell proliferation & produce a mitogenic response. TGFalpha interacts with the PDZ domains of MAGI3, SDCBP & SNTA1. The interaction with SDCBP is required for the targeting to the cell surface.
Description
Recombinant Human Transforming Growth Factor alpha is produced by our E.coli expression system & the target gene encoding Val41-Val90 is expressed.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Formulation
Lyophilized from a 0.2 um filtered solution of 10mM Acetic Acid .
Molecular Weight
5, 55
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Seq Length
Val41-Val90
Ship Description
The product is shipped at ambient temperature.
Storage
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen