« Zurück
Home /
B-type Natriuretic Peptide Human Recombinant ( BNP Human )

B-type Natriuretic Peptide Human Recombinant ( BNP Human )

ArtNr	PT_41632_25mg
Hersteller	Novateinbio
Menge	25 mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Description	B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary chromatographic techniques.
Storage/Stability	Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution NPPB should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Purity	Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Form	Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride.
Protein Background	Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
Expression host	Escherichia Coli.
Reagent Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Amino acid sequence	SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Solubility	It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Manufacturers Category	Other

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 mg

lieferbar

Lieferung vsl. bis 11.10.2024

Express-Lieferung: 9 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail