« Zurück
Home /
PIK3CB (phosphoinositide-3-kinase. catalytic. beta polypeptide)

PIK3CB (phosphoinositide-3-kinase. catalytic. beta polypeptide)

Hersteller	GENWAY
Kategorie	Oncology By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Peptides & Proteins Cell Biology Cell Status Adenocarcinoma Mesothelioma Western Blot Autophagy Cardiovascular Research Proliferation Myocardial Infarction Peptides
Typ	Peptides
Specific against	other
Applikationen	WB
Menge	0.1 mg
ArtNr	18-003-43812
eClass 6.1	34160400
eClass 9.0	32160409
Lieferbar
Alias	GWB-390C54
Genway ID:	GWB-390C54
Antigen Specificity:	Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human PIK3CB.
Immunogen:	Synthetic peptide sequence derived from: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD
Gene ID:	5291
Appearance:	Lyophilized powderAntibody dilution : 5. 0& #956; g/ml Immunohistochemistry: Not Verified
ELISA Titre:	1:62500
Category:	Signaling Intermediates
Note:	Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various m
Function:	Phosphorylates PtdIns PtdIns4P and PtdIns(4 5)P2 with a preference for PtdIns(4 5)P2.
Catalytic Activity:	ATP + 1-phosphatidyl-1D-myo-inositol 4 5-bisphosphate = ADP + 1-phosphatidyl-1D-myo-inositol 3 4 5-trisphosphate.
Pathway:	Phospholipid metabolism; phosphatidylinositol phosphate biosynthesis.
Subunit:	Heterodimer of a p110 (catalytic) and a p85 (regulatory) subunit.
Tissue Specificity:	Expressed ubiquitously.
Similarity:	Belongs to the PI3/PI4-kinase family.
Similarity:	Contains 1 PI3K/PI4K domain. Summary: Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110-kD catalytic subunit such as PIK3CB and an 85-kD adaptor subunit (Hu et al. 1993 [PubMed 8246984]). [supplied by OMIM]. Zhao. J. J. . et al. . (2005) Proc. Natl. Acad. Sci. U. S. A. 102 (51). 18443-18448.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.1 mg

lieferbar

Lieferung vsl. bis 26.07.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern