« Zurück
Home /
CBR1 (carbonyl reductase 1)

CBR1 (carbonyl reductase 1)

ArtNr	18-003-44773
Hersteller	GENWAY
Menge	0.1 mg
Kategorie	Antibodies Western Blot Primary Antibodies
Typ	Antibody
Applikationen	WB
Specific against	other
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GWB-2B0843
Similar products	18-003-44773
Lieferbar
Genway ID:	GWB-2B0843
Antigen Specificity:	Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human CBR1.
Immunogen:	Synthetic peptide sequence derived from: PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Appearance:	Lyophilized powder
Western Blotting:	Antibody
Dilution:	1. 25 & #956; g/ml
Handling:	Add 100 & #956; l of distilled water to this antibody before use.
ELISA Titre:	1:62500
Note:	Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. Carbonyl reductase is one of several monomeric. NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Carbonyl reductase is one of several monomeric. NADPH-dependent oxidoreducta
Function:	Catalyzes the reduction of a wide variety of carbonyl compounds including the antitumor anthracycline antibiotics. Can convert prostaglandin E2 to prostaglandin F2-alpha.
Catalytic Activity:	R-CHOH-R\' + NADP+ = R-CO-R\' + NADPH.
Catalytic Activity:	(5Z 13E)-(15S)-9-alpha 11-alpha 15-trihydroxyprosta-5 13-dienoate + NADP+ = (5Z 13E)-(15S)-11-alpha 15-dihydroxy-9-oxoprosta-5 13-dienoate + NADPH.
Catalytic Activity:	(13E)-(15S)-11-alpha 15-dihydroxy-9-oxoprost-13-enoate + NADP+ = (13E)-11-alpha-hydroxy-9 15-dioxoprost-13-enoate + NADPH.
Subunit:	Monomer.
Subcellular Location:	Cytoplasm.
Similarity:	Belongs to the short-chain dehydrogenases/reductases (SDR) family. Summary: Carbonyl reductase is one of several monomeric NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene CRB3 lies close to this gene on chromosome 21q. Cheon. M. S. . (2003) Amino Acids 25 (1). 41-47.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.1 mg

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail