ArtNr |
Z02827-1 |
Hersteller |
GenScript
|
Menge |
1mg(2x500ug) |
Kategorie |
|
Typ |
Proteins |
Format |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Specific against |
Human |
Purity |
>97% by SDS-PAGE and HPLC analyses. |
Sequence |
GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
protein/Z02827-Lymphotactin_XCL1_Human, Lymphotactin is the only known member of the C-chemokine family and signals through the receptor XCR1, formally known as GPR5. The spleen shows the highest level of lymphotactin compared to peripheral leukocytes, lung, colon and small intestine. Lymphotactin is chemotactic towards lymphocytes but not towards monocytes or neutrophils.</td></tr><tr><th>M.W.</th><td colspan="7"> 10.0 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >97% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rHuCXCL13 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of & |
Similar products |
Lymphotactin/XCL1 |
Lieferbar |
|
Specificity |
Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of >, 1.0 x 104 IU/mg. |
Specificity |
Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of >, 1.0 x 104 IU/mg. |
Description |
Lymphotactin is the only known member of the C-chemokine family and signals through the receptor XCR1, formally known as GPR5. The spleen shows the highest level of lymphotactin compared to peripheral leukocytes, lung, colon and small intestine. Lymphotactin is chemotactic towards lymphocytes but not towards monocytes or neutrophils. |
Endotoxin Level |
Less than 0.2EU/ug of rHuCXCL13 as determined by LAL method. |
Formulation |
Lyophilized from a 0.2µ, m filtered concentrated, solution in 20mM PB, pH7.4, 150mM NaCl. |
M.W. |
10.0 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids. |
Product Line |
Cytokine, Chemokines & Growth Factors |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °, C. Further dilutions should be made in appropriate buffered solutions. |
Storage |
This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles. |
Usage |
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. |
Product Origin |
USA |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.