« Zurück
Home /
Lymphotactin/XCL1, Human

Lymphotactin/XCL1, Human

ArtNr	Z02827-1
Hersteller	GenScript
Menge	1mg(2x500ug)
Kategorie	Oncology Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Migration & Invasion By Organ Lung Cancer Colorectal Cancer
Typ	Proteins
Format	Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against	Human
Purity	>97% by SDS-PAGE and HPLC analyses.
Sequence	GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	protein/Z02827-Lymphotactin_XCL1_Human, Lymphotactin is the only known member of the C-chemokine family and signals through the receptor XCR1, formally known as GPR5. The spleen shows the highest level of lymphotactin compared to peripheral leukocytes, lung, colon and small intestine. Lymphotactin is chemotactic towards lymphocytes but not towards monocytes or neutrophils.</td></tr><tr><th>M.W.</th><td colspan="7"> 10.0 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >97% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rHuCXCL13 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of &
Similar products	Lymphotactin/XCL1
Lieferbar
Specificity	Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of ＞, 1.0 x 104 IU/mg.
Specificity	Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 100 ng/ml, corresponding to a specific activity of ＞, 1.0 x 104 IU/mg.
Description	Lymphotactin is the only known member of the C-chemokine family and signals through the receptor XCR1, formally known as GPR5. The spleen shows the highest level of lymphotactin compared to peripheral leukocytes, lung, colon and small intestine. Lymphotactin is chemotactic towards lymphocytes but not towards monocytes or neutrophils.
Endotoxin Level	Less than 0.2EU/ug of rHuCXCL13 as determined by LAL method.
Formulation	Lyophilized from a 0.2µ, m filtered concentrated, solution in 20mM PB, pH7.4, 150mM NaCl.
M.W.	10.0 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids.
Product Line	Cytokine, Chemokines & Growth Factors
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °, C. Further dilutions should be made in appropriate buffered solutions.
Storage	This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Usage	This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Product Origin	USA

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Z02827-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg(2x500ug)

lieferbar

Lieferung vsl. bis 06.09.2024

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail