« Zurück
Home /
Apelin-36, bovine

Apelin-36, bovine

ArtNr	RP13713
Hersteller	GenScript
Menge	0.1mg
Kategorie	Oncology Neuroscience Metabolism Glucose Homeostasis Molecular Targets for Neuroscience By Cell Type Hematology Lymphoma Peptides & Proteins Obesity Peptides
Typ	Peptides
Specific against	Cattle
Purity	> 95%
Sequence	LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF ; {LEU}{VAL}{GLN}{PRO}{ARG}{GLY}{PRO}{ARG}{SER}{GLY}{PRO}{GLY}{PRO}{TRP}{GLN}{GLY}{GLY}{ARG}{ARG}{LYS}{PHE}{ARG}{ARG}{GLN}{ARG}{PRO}{ARG}{LEU}{SER}{HIS}{LYS}{GLY}{PRO}{MET}{PRO}{PHE}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP13713-Apelin-36_Bovine, Apelin, a recently isolated neuropeptide that is expressed in the supraoptic and the paraventricular nuclei, acts on specific receptors located on vasopressinergic neurons. Apelin-36 belongs to the apelin family. Apelin is the natural ligand of the orphan receptor APJ and is abundantly secreted in the colostrum. Apelin-36 has a greater inhibitory activity on HIV infection than other synthetic apelin derivatives. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. Store in a cool dry place. </td></tr>
Similar products	Apelin-36
Lieferbar
Description	Apelin, a recently isolated neuropeptide that is expressed in the supraoptic and the paraventricular nuclei, acts on specific receptors located on vasopressinergic neurons. Apelin-36 belongs to the apelin family. Apelin is the natural ligand of the orphan receptor APJ and is abundantly secreted in the colostrum. Apelin-36 has a greater inhibitory activity on HIV infection than other synthetic apelin derivatives.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Storage	Store at -20C. Keep tightly closed. Store in a cool dry place.
Product Origin	USA

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.1mg

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail