ArtNr |
CSB-YP011587SH-500 |
Hersteller |
Cusabio
|
Menge |
500ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Cytotoxic lymphocyte maturation factor 40KDA subunit ;CLMF p40IL-12 subunit p40 |
Lieferbar |
|
Research Topic |
Others |
Uniprot ID |
P68220 |
Gene Names |
IL12B |
Organism |
Ovis aries (Sheep) |
AA Sequence |
IWELEKNVYVVELDWYPNAPGETVVLTCDTPEEDG ITWTSDQSSEVLGSGKTLTIQVKEFGDAGQYTCHK GGEVLSRSLLLLHKKEDGIWSTDILKDQKEPKAKS FLKCEAKDYSGHFTCSWLTAISTNLKFSVKSSRGS SDPRGVTCGAASLSAEKVSMDHREYNKYTVECQEG SACPAAEESLPIEVVMEAVHKLKYENYTSSFFIRD IIKPDPPKNLQLRPLKNSRQVEVSWEYPDTWSTPH SYFSLTFCVQVQGKNKREKKLFTDQTSAKVTCHKD ANIRVQARDRYYSSFWSEWASVSCS |
Expression Region |
23-327aa |
Sequence Info |
Full Length of Mature Protein |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
36.5 kDa |
Alternative Name(s) |
Cytotoxic lymphocyte maturation factor 40KDA subunit ; CLMF p40IL-12 subunit p40 |
Relevance |
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates mory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis . |
Reference |
Ovine interleukin 12 has biological activity on ovine and human activated peripheral blood mononuclear cells.Swinburne S.J., Russ G.R., Krishnan R.Cytokine 12:1546-1552(2000) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC. |
Subcellular Location |
Secreted |
Protein Families |
Type I cytokine receptor family, Type 3 subfamily |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.