ArtNr |
CSB-EP019548RA-50 |
Hersteller |
Cusabio
|
Menge |
50ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Islet of Langerhans regenerating protein 3 ;REG 3Lithostathine 3;Pancreatitis-associated protein 2RegIIIRegenerating islet-derived protein III-alpha ;Reg III-alpha |
Lieferbar |
|
Research areas |
Others |
Target / Protein |
Reg3a |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Rattus norvegicus (Rat) |
Uniprot ID |
P35231 |
AA Sequence |
EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSW FQADLACQKRPSGHLVSILSGGEASFVSSLVTGRV NNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYL NWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVE LPFVCKFKQ |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
26-174aa |
Protein length |
Full Length of Mature Protein |
MW |
20.5 kDa |
Alternative Name(s) |
Islet of Langerhans regenerating protein 3 ; REG 3Lithostathine 3; Pancreatitis-associated protein 2RegIIIRegenerating islet-derived protein III-alpha ; Reg III-alpha |
Relevance |
Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway . |
References |
Identification of a second rat pancreatitis-associated protein. Messenger RNA cloning, gene structure, and expression during acute pancreatitis.Frigerio J.-M., Dusetti N.J., Keim V., Dagorn J.-C., Iovanna J.L.Biochemistry 32:9236-9241(1993) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway (By similarity). |
Involvement in disease |
Overexpressed during the acute phase of pancreatitis. |
Subcellular Location |
Secreted |
Tissue Specificity |
Low expression found in healthy pancreas. |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.