« Zurück
Home /
Recombinant Agrobacterium sp.3-phosphoshikimate 1-carboxyvinyltransferase(aroA)

Recombinant Agrobacterium sp.3-phosphoshikimate 1-carboxyvinyltransferase(aroA)

ArtNr	CSB-YP870830ALAE-100
Hersteller	Cusabio
Menge	100ug
Kategorie	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	5-enolpyruvylshikimate-3-phosphate synthase,Short name:,EPSP synthase,Short name:,EPSPS
Lieferbar
Research Areas	Others
Uniprot ID	Q9R4E4
Gene Names	aroA
Organism	Agrobacterium sp. (strain CP4)
AA Sequence	MSHGASSRPATARKSSGLSGTVRIPGDKSISHRSF MFGGLASGETRITGLLEGEDVINTGKAMQAMGARI RKEGDTWIIDGVGNGGLLAPEAPLDFGNAATGCRL TMGLVGVYDFDSTFIGDASLTKRPMGRVLNPLREM GVQVKSEDGDRLPVTLRGPKTPTPITYRVPMASAQ VKSAVLLAGLNTPGITTVIEPIMTRDHTEKMLQGF GANLTVETDADGVRTIRLEGRGKLTGQVIDVPGDP SSTAFPLVAALLVPGSDVTILNVLMNPTRTGLILT LQEMGADIEVINPRLAGGEDVADLRVRSSTLKGVT VPEDRAPSMIDEYPILAVAAAFAEGATVMNGLEEL RVKESDRLSAVANGLKLNGVDCDEGETSLVVRGRP DGKGLGNASGAAVATHLDHRIAMSFLVMGLVSENP VTVDDATMIATSFPEFMDLMAGLGAKIELSDTKAA
Expression Region	1-455aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	49.6 kDa
Alternative Name(s)	5-enolpyruvylshikimate-3-phosphate synthase Short name: EPSP synthase Short name: EPSPS
Relevance	Catalyzes the transfer of the enolpyruvyl moiety of phosphoenolpyruvate (PEP) to the 5-hydroxyl of shikimate-3-phosphate (S3P) to produce enolpyruvyl shikimate-3-phosphate and inorganic phosphate.
Reference	Molecular basis for the herbicide resistance of Roundup Ready crops.Funke T., Han H., Healy-Fried M.L., Fischer M., Schonbrunn E.Proc. Natl. Acad. Sci. U.S.A. 103:13010-13015(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the transfer of the enolpyruvyl moiety of phosphoenolpyruvate (PEP) to the 5-hydroxyl of shikimate-3-phosphate (S3P) to produce enolpyruvyl shikimate-3-phosphate and inorganic phosphate.
Subcellular Location	Cytoplasm
Protein Families	EPSP synthase family
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen