ArtNr |
CSB-YP863638HU-10 |
Hersteller |
Cusabio
|
Menge |
10ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Phosphatidylcholine 2-acylhydrolase 12A |
Lieferbar |
|
Research Topic |
Metabolism |
Uniprot ID |
Q9BZM1 |
Gene Names |
PLA2G12A |
Organism |
Homo sapiens (Human) |
AA Sequence |
QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLG GEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLF GVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEE FQYCLSKICRDVQKTLGLTQHVQACETTVELLFDS VIHLGCKPYLDSQRAACRCHYEE |
Expression Region |
23-185aa |
Sequence Info |
Partial |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
20.3 kDa |
Alternative Name(s) |
Phosphatidylcholine 2-acylhydrolase 12A |
Relevance |
PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine. |
Reference |
Cloning and recombinant expression of a structurally novel human secreted phospholipase A2.Gelb M.H., Valentin E., Ghomashchi F., Lazdunski M., Lambeau G.J. Biol. Chem. 275:39823-39826(2000) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine. |
Subcellular Location |
Secreted, Cytoplasm |
Protein Families |
Phospholipase A2 family |
Tissue Specificity |
Abundantly expressed in heart, skeletal muscle, kidney, liver and pancreas. |
Paythway |
Vascularsmoothmusclecontraction |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.