« Zurück
Home /
Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase(pat)

Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase(pat)

ArtNr	CSB-YP701139FOQ-200
Hersteller	Cusabio
Menge	200ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Streptomyces viridochromogenes
Target / Protein	pat
Biologically active	Not Test
Expression system	Yeast
Species of origin	Streptomyces viridochromogenes (strain DSM 40736 / JCM 4977 / BCRC 1201 / Tue 494)
Uniprot ID	Q57146
AA Sequence	MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVN FRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAG IAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGST LYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEAL GYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPR PVRPVTQI
Tag Info	N-terminal 6xHis-tagged
Expression Region	1-183aa
Protein length	Full Length
MW	22.6 kDa
Alternative Name(s)	PPT N-acetyltransferase; Phosphinothricin-resistance protein
Relevance	Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance.
References	"Cloning of a phosphinothricin N-acetyltransferase gene from Streptomyces viridochromogenes Tue494 and its expression in Streptomyces lividans and Escherichia coli."Strauch E., Wohlleben W., Puehler A.Gene 63:65-74(1988).
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance.
Protein Families	Acetyltransferase family, PAT/BAR subfamily
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen