« Zurück
Home /
Recombinant Klebsiella pneumoniae Metallo-beta-lactamase type 2(blaNDM-1)

Recombinant Klebsiella pneumoniae Metallo-beta-lactamase type 2(blaNDM-1)

ArtNr	CSB-YP510513KBG-200
Hersteller	Cusabio
Menge	200ug
Kategorie	Food Safety Antibiotics Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Metallo-beta-lactamase NDM-1
Lieferbar
Research Topic	Others
Uniprot ID	C7C422
Gene Names	blaNDM-1
Organism	Klebsiella pneumoniae
AA Sequence	GEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTS YLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQT AQILNWIKQEINLPVALAVVTHAHQDKMGGMDALH AAGIATYANALSNQLAPQEGMVAAQHSLTFAANGW VEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDI AFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGA AFPKASMIVMSHSAPDSRAAITHTARMADKLR
Expression Region	29-270aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	27.6 kDa
Alternative Name(s)	Metallo-beta-lactamase NDM-1
Relevance	Confers resistance to many beta-lactam antibiotics, including some carbapens. Does not confer resistance to the polymixin colistin or the fluoroquinolone ciprofloxacin.
Reference	Emergence of a new antibiotic resistance mechanism in India, Pakistan, and the UK a molecular, biological, and epidemiological study.Kumarasamy K.K., Toleman M.A., Walsh T.R., Bagaria J., Butt F., Balakrishnan R., Chaudhary U., Doumith M., Giske C.G., Irfan S., Krishnan P., Kumar A.V., Maharjan S., Mushtaq S., Noorie T., Paterson D.L., Pearson A., Perry C. , Pike R., Rao B., Ray U., Sarma J.B., Sharma M., Sheridan E., Thirunarayan M.A., Turton J., Upadhyay S., Warner M., Welfare W., Livermore D.M., Woodford N.Lancet Infect. Dis. 10:597-602(2010)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. Does not confer resistance to the polymixin colistin or the fluoroquinolone ciprofloxacin.
Subcellular Location	Periplasm
Protein Families	Metallo-beta-lactamase superfamily, Class-B beta-lactamase family
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP510513KBG-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen