« Zurück
Home /
Recombinant Arabidopsis thaliana Nucleoside diphosphate kinase 1(NDK1)

Recombinant Arabidopsis thaliana Nucleoside diphosphate kinase 1(NDK1)

ArtNr	CSB-YP336542DOA-200
Hersteller	Cusabio
Menge	200ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	Myc
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Nucleoside diphosphate kinase I,Short name:NDK I,Short name:NDP kinase I,Short name:NDPK I
Lieferbar
Research areas	Others
Target / Protein	NDK1
Biologically active	Not Test
Expression system	Yeast
Species of origin	Arabidopsis thaliana (Mouse-ear cress)
Uniprot ID	P39207
AA Sequence	MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGL KLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPV VAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDF AIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQS SVHPWVYET
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region	1-149aa
Protein length	Full Length
MW	20.5 kDa
Alternative Name(s)	Nucleoside diphosphate kinase I Short name:NDK I Short name:NDP kinase I Short name:NDPK I
Relevance	Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress.
References	"Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana."Mayer K.F.X., Schueller C., Wambutt R., Murphy G., Volckaert G., Pohl T., Duesterhoeft A., Stiekema W., Entian K.-D., Terryn N., Harris B., Ansorge W., Brandt P., Grivell L.A., Rieger M., Weichselgartner M., de Simone V., Obermaier B. McCombie W.R.Nature 402:769-777(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Plays a role in response to reactive oxygen species (ROS) stress.
Subcellular Location	Peroxisome, Nucleus, Cytoplasm
Protein Families	NDK family
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen