« Zurück
Home /
Recombinant Rat Regenerating islet-derived protein 3-beta(Reg3b)

Recombinant Rat Regenerating islet-derived protein 3-beta(Reg3b)

ArtNr	CSB-YP326510RA-50
Hersteller	Cusabio
Menge	50ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Others
Uniprot ID	P25031
Gene Names	Reg3b
Organism	Rattus norvegicus (Rat)
AA Sequence	EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTW FDAELACQKRPEGHLVSVLNVAEASFLASMVKNTG NSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYV NWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVK LPYVCKFTG
Expression Region	27-175aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-sumostar-tagged
MW	32.6 kDa
Alternative Name(s)	Pancreatitis-associated protein 1; Peptide 23REG-2Regenerating islet-derived protein III-beta ; Reg III-beta
Relevance	Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues .
Reference	Messenger RNA sequence and expression of rat pancreatitis-associated protein, a lectin-related protein overexpressed during acute experimental pancreatitis.Iovanna J., Orelle B., Keim V., Dagorn J.-C.J. Biol. Chem. 266:24664-24669(1991)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues (By similarity).
Involvement in disease	Overexpressed during the acute phase of pancreatitis.
Subcellular Location	Secreted
Tissue Specificity	Constitutively expressed in intestine.
Tag Information	N-terminal 6xHis-sumostar-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen