« Zurück
Home /
Recombinant Silene chalcedonica Ribosome-inactivating protein lychnin

Recombinant Silene chalcedonica Ribosome-inactivating protein lychnin

ArtNr	CSB-YP307648LKN-50
Hersteller	Cusabio
Menge	50ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Others
Uniprot ID	P85101
Gene Names	N/A
Organism	Silene chalcedonica (Maltese-cross) (Lychnis chalcedonica)
AA Sequence	RPSWTVDSDSAKYSSFLDSLREEFGRGTPKVCNIP VTKKANNDKFVLVNLVLPFNRNTITLAFRASDAYL VGFQDRDSKTNKLRANFFSDEYRALSGKYKSIFTD AEVLAPALPCASTYTDLQNKAGVSREKLSLGVSSL QTAFTAVYGKVFTGKNVAKFALISIQMVAEAARFK YIEDQVINRGMYSSFEAGARITLLENNWSKISEQY HKSCKLGGGQFTEEEMKLGLLLYN
Expression Region	1-234aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	28.1 kDa
Relevance	Ribosome-inactivating protein of type 1, inhibits protein synthesis in animal cells. Inhibits cell-free translation in rabbit reticulocyte lysate system with an IC50 of 0.17 nM.
Reference	"Sequence determination of lychnin, a type 1 ribosome-inactivating protein from Lychnis chalcedonica seeds."Chambery A., de Donato A., Bolognesi A., Polito L., Stirpe F., Parente A.Biol. Chem. 387:1261-1266(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Ribosome-inactivating protein of type 1, inhibits protein synthesis in animal cells. Inhibits cell-free translation in rabbit reticulocyte lysate system with an IC(50) of 0.17 nM.
Protein Families	Ribosome-inactivating protein family, Type 1 RIP subfamily
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen