« Zurück
Home /
Recombinant Viscum album Beta-galactoside-specific lectin 1,partial

Recombinant Viscum album Beta-galactoside-specific lectin 1,partial

ArtNr	CSB-YP305846VDO-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Others
Target / Protein	N/A
Biologically active	Not Test
Expression system	Yeast
Species of origin	Viscum album (European mistletoe)
Uniprot ID	P81446
AA Sequence	YERLRLRVTHQTTGEEYFRFITLLRDYVSSGSFSN EIPLLRQSTIPVSDAQRFVLVELTNEGGDSITAAI DVTNLYVVAYQAGDQSYFLRDAPRGAETHLFTGTT RSSLPFNGSYPDLERYAGHRDQIPLGIDQLIQSVT ALRFPGGSTRTQARSILILIQMISEAARFNPILWR ARQYINSGASFLPDVYMLELETSWGQQSTQVQQST DGVFNNPIRLAIPPGNFVTLTNVRDVIASLAIMLF VCGERPSSS
Tag Info	N-terminal 6xHis-tagged
Expression Region	34-287aa
Protein length	Partial
MW	30.4 kDa
Alternative Name(s)	Beta-galactoside-specific lectin I Viscumin
Relevance	The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4, 324 of 28S rRNA. The B chain binds to cell receptors and probably facilitates the entry into the cell of the A chain; B chains are also responsible for cell agglutination (lectin activity). Inhibits growth of the human tumor cell line Molt4.
References	"Purification and characterization of four isoforms of Himalayan mistletoe ribosome-inactivating protein from Viscum album having unique sugar affinity." Mishra V., Sharma R.S., Yadav S., Babu C.R., Singh T.P. Arch. Biochem. Biophys. 423:288-301(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4, 324 of 28S rRNA. The B chain binds to cell receptors and probably facilitates the entry into the cell of the A chain; B chains are also responsible for cell agglutination (lectin activity). Inhibits growth of the human tumor cell line Molt4.
Protein Families	Ribosome-inactivating protein family, Type 2 RIP subfamily
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen