« Zurück
Home /
Recombinant Human Elongation factor Tu, mitochondrial(TUFM)

Recombinant Human Elongation factor Tu, mitochondrial(TUFM)

ArtNr	CSB-YP025342HU-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	P43
Lieferbar
Research Topic	Metabolism
Uniprot ID	P49411
Gene Names	TUFM
Organism	Homo sapiens (Human)
AA Sequence	AVEAKKTYVRDKPHVNVGTIGHVDHGKTTLTAAIT KILAEGGGAKFKKYEEIDNAPEERARGITINAAHV EYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCI LVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKA DAVQDSEMVELVELEIRELLTEFGYKGEETPVIVG SALCALEGRDPELGLKSVQKLLDAVDTYIPVPARD LEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGD ECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLG ALVRGLKREDLRRGLVMVKPGSIKPHQKVEAQVYI LSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPP EKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGN RTIGTGLVTNTLAMTEEEKNIKWG
Expression Region	44-452aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	47 kDa
Alternative Name(s)	P43
Relevance	This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.
Reference	Cloning, sequence analysis and expression of mammalian mitochondrial protein synthesis elongation factor Tu.Woriax V.L., Burkhart W.A., Spremulli L.L.Biochim. Biophys. Acta 1264:347-356(1995)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.
Involvement in disease	Combined oxidative phosphorylation deficiency 4 (COXPD4)
Subcellular Location	Mitochondrion
Protein Families	TRAFAC class translation factor GTPase superfamily, Classic translation factor GTPase family, EF-Tu/EF-1A subfamily
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen