Vergleich

Recombinant Human E3 ubiquitin-protein ligase TRIM21(TRIM21)

ArtNr CSB-YP024457HU-1
Hersteller Cusabio
Menge 1mg
Quantity options 1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Yeast
Purity Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 52KDA Ro protein52KDA ribonucleoprotein autoantigen Ro/SS-ARING finger protein 81Ro(SS-A)Sjoegren syndrome type A antigen ;SS-ATripartite motif-containing protein 21
Lieferbar
Research areas
Epigenetics and Nuclear Signaling
Target / Protein
TRIM21
Biologically active
Not Test
Expression system
Yeast
Species of origin
Homo sapiens (Human)
Uniprot ID
P19474
AA Sequence
MASAARLTMMWEEVTCPICLDPFVEPVSIECGHSF CQECISQVGKGGGSVCPVCRQRFLLKNLRPNRQLA NMVNNLKEISQEAREGTQGERCAVHGERLHLFCEK DGKALCWVCAQSRKHRDHAMVPLEEAAQEYQEKLQ VALGELRRKQELAEKLEVEIAIKRADWKKTVETQK SRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRI LGEKEAKLAQQSQALQELISELDRRCHSSALELLQ EVIIVLERSESWNLKDLDITSPELRSVCHVPGLKK MLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQ QSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTG KEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNK QKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSF YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGK NTAPLTLCPLNIGSQGSTDY
Tag Info
N-terminal 6xHis-tagged
Expression Region
1-475aa
Protein length
Full Length
MW
56.2 kDa
Alternative Name(s)
52KDA Ro protein52KDA ribonucleoprotein autoantigen Ro/SS-ARING finger protein 81Ro(SS-A)Sjoegren syndrome type A antigen ; SS-ATripartite motif-containing protein 21
Relevance
E3 ubiquitin-protein ligase whose activity is dependent on E2 enzymes, UBE2D1, UBE2D2, UBE2E1 and UBE2E2. Forms a ubiquitin ligase complex in cooperation with the E2 UBE2D2 that is used not only for the ubiquitination of USP4 and IKBKB but also for its self-ubiquitination. Component of cullin-RING-based SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes such as SCF(SKP2)-like complexes. A TRIM21-containing SCF(SKP2)-like complex is shown to mediate ubiquitination of CDKN1B ('Thr-187' phosphorylated-form), thereby promoting its degradation by the proteasome. Monoubiquitinates IKBKB that will negatively regulates Tax-induced NF-kappa-B signaling. Negatively regulates IFN-beta production post-pathogen recognition by polyubiquitin-mediated degradation of IRF3. Mediates the ubiquitin-mediated proteasomal degradation of IgG1 heavy chain, which is linked to the VCP-mediated ER-associated degradation (ERAD) pathway. Promotes IRF8 ubiquitination, which enhanced the ability of IRF8 to stimulate cytokine genes transcription in macrophages. Plays a role in the regulation of the cell cycle progression. Enhances the decapping activity of DCP2. Exists as a ribonucleoprotein particle present in all mammalian cells studied and composed of a single polypeptide and one of four small RNA molecules. At least two isoforms are present in nucleated and red blood cells, and tissue specific differences in RO/SSA proteins have been identified. The common feature of these proteins is their ability to bind HY RNAs.2
References
Protein heterogeneity in the human Ro/SSA ribonucleoproteins. The 52- and 60-kD Ro/SSA autoantigens are encoded by separate genes.Itoh K., Itoh Y., Frank M.B.J. Clin. Invest. 87:177-186(1991)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
E3 ubiquitin-protein ligase whose activity is dependent on E2 enzymes, UBE2D1, UBE2D2, UBE2E1 and UBE2E2. Forms a ubiquitin ligase complex in cooperation with the E2 UBE2D2 that is used not only for the ubiquitination of USP4 and IKBKB but also for its self-ubiquitination. Component of cullin-RING-based SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes such as SCF(SKP2)-like complexes. A TRIM21-containing SCF(SKP2)-like complex is shown to mediate ubiquitination of CDKN1B ('Thr-187' phosphorylated-form), thereby promoting its degradation by the proteasome. Monoubiquitinates IKBKB that will negatively regulates Tax-induced NF-kappa-B signaling. Negatively regulates IFN-beta production post-pathogen recognition by polyubiquitin-mediated degradation of IRF3. Mediates the ubiquitin-mediated proteasomal degradation of IgG1 heavy chain, which is linked to the VCP-mediated ER-associated degradation (ERAD) pathway. Promotes IRF8 ubiquitination, which enhanced the ability of IRF8 to stimulate cytokine genes transcription in macrophages. Plays a role in the regulation of the cell cycle progression. Enhances the decapping activity of DCP2. Exists as a ribonucleoprotein particle present in all mammalian cells studied and composed of a single polypeptide and one of four small RNA molecules. At least two isoforms are present in nucleated and red blood cells, and tissue specific differences in RO/SSA proteins have been identified. The common feature of these proteins is their ability to bind HY RNAs.2. Involved in the regulation of innate immunity and the inflammatory response in response to IFNG/IFN-gamma. Organizes autophagic machinery by serving as a platform for the assembly of ULK1, Beclin 1/BECN1 and ATG8 family members and recognizes specific autophagy targets, thus coordinating target recognition with assembly of the autophagic apparatus and initiation of autophagy. Acts as an autophagy receptor for the degradation of IRF3, hence attenuating type I interferon (IFN)-dependent immune responses
Subcellular Location
Cytoplasm, Cytoplasmic vesicle, autophagosome, Nucleus, Cytoplasm, P-body
Protein Families
TRIM/RBCC family
Tissue Specificity
Isoform 1 and isoform 2 are expressed in fetal and adult heart and fetal lung.
Tag Information
N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen