« Zurück
Home /
Recombinant Oncorhynchus mykiss Transforming growth factor beta-1(TGFB1)

Recombinant Oncorhynchus mykiss Transforming growth factor beta-1(TGFB1)

ArtNr	CSB-YP023446OEI-50
Hersteller	Cusabio
Menge	50ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Short name:,TGF-beta-1
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	O93449
Gene Names	TGFB1
Organism	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
AA Sequence	QTTTEEICSDKSESCCVRKLYIDFRKDLGWKWIHE PTGYFANYCIGPCTYIWNTENKYSQVLALYKHHNP GASAQPCCVPQVLEPLPIIYYVGRQHKVEQLSNMI VKSCRCS
Expression Region	271-382aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	15 kDa
Alternative Name(s)	Short name: TGF-beta-1
Relevance	Likely to be an important cytokine regulating immune response. May also have a role in other physiological systems.
Reference	"Isolation of the first piscine transforming growth factor beta gene: analysis reveals tissue specific expression and a potential regulatory sequence in rainbow trout (Oncorhynchus mykiss)."Hardie L.J., Laing K.J., Daniels G.D., Grabowski P.S., Cunningham C., Secombes C.J.Cytokine 10:555-563(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Likely to be an important cytokine regulating immune response. May also have a role in other physiological systems.
Subcellular Location	Secreted
Protein Families	TGF-beta family
Tissue Specificity	Expressed in blood leucocytes, kidney macrophages, brain, gill and spleen but not in liver.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen