ArtNr |
CSB-YP023129HU-1 |
Hersteller |
Cusabio
|
Menge |
1mg |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Short name:,TDP-43 |
Lieferbar |
|
Research Topic |
Microbiology |
Uniprot ID |
Q13148 |
Gene Names |
TARDBP |
Organism |
Homo sapiens (Human) |
AA Sequence |
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQF PGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGN LVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSD LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLK TGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDC KLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREF FSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCG EDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNP GGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGA FSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPS GNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGW GSASNAGSGSG |
Expression Region |
1-396aa |
Sequence Info |
Partial |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
44.9 kDa |
Alternative Name(s) |
Short name: TDP-43 |
Relevance |
DNA and RNA-binding protein which regulates transcription and splicing. Involved in the regulation of CFTR splicing. It promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. May also be involved in microRNA biogenesis, apoptosis and cell division. Can repress HIV-1 transcription by binding to the HIV-1 long terminal repeat. Stabilizes the low molecular weight neurofilament (NFL) mRNA through a direct interaction with the 3' UTR. |
Reference |
"TDP43 is a human low molecular weight neurofilament (hNFL) mRNA-binding protein." Strong M.J., Volkening K., Hammond R., Yang W., Strong W., Leystra-Lantz C., Shoesmith C. Mol. Cell. Neurosci. 35:320-327(2007) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
DNA and RNA-binding protein which regulates transcription and splicing. Involved in the regulation of CFTR splicing. It promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. May also be involved in microRNA biogenesis, apoptosis and cell division. Can repress HIV-1 transcription by binding to the HIV-1 long terminal repeat. Stabilizes the low molecular weight neurofilament (NFL) mRNA through a direct interaction with the 3' UTR. |
Involvement in disease |
Amyotrophic lateral sclerosis 10 (ALS10) |
Subcellular Location |
Nucleus |
Tissue Specificity |
Ubiquitously expressed. In particular, expression is high in pancreas, placenta, lung, genital tract and spleen. |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.