« Zurück
Home /
Recombinant Human Secreted Ly-6/uPAR-related protein 1(SLURP1)

Recombinant Human Secreted Ly-6/uPAR-related protein 1(SLURP1)

ArtNr	CSB-YP021784MO-100
Hersteller	Cusabio
Menge	100ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	Yeast
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Alternative Name(s)	ARS component B ARS(component B)-81/S Anti-neoplastic urinary protein Short name: ANUP
AA Sequence	LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTV EAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIF CCFRDLCNSEL
Research Topic	Cardiovascular
Uniprot ID	P55000
Gene Names	SLURP1
Tag Info	N-terminal 6xHis-tagged
Expression Region	23-103aa
MW of Fusion Proten	10, 9
Sequence Info	Full Length
Relevance	Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin.
Reference	"Partial N-terminal amino acid sequence of the anti-neoplastic urinary protein (ANUP) and the anti-tumour effect of the N-terminal nonapeptide of the unique cytokine present in human granulocytes."Ridge R.J., Sloane N.H.Cytokine 8:1-5(1996)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Homo sapiens (Human)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen