Vergleich

Recombinant Mouse Nuclear receptor ROR-gamma(Rorc)

ArtNr CSB-YP020071MO-1
Hersteller Cusabio
Menge 1mg
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host Yeast
Purity Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Nuclear receptor RZR-gamma,Nuclear receptor subfamily 1 group F member 3,RAR-related orphan receptor C,Retinoid-related orphan receptor-gamma,Thymus orphan receptor,Short name:,TOR
Lieferbar
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P51450
Gene Names
Rorc
Organism
Mus musculus (Mouse)
AA Sequence
MDRAPQRHHRTSRELLAAKKTHTSQIEVIPCKICG DKSSGIHYGVITCEGCKGFFRRSQQCNVAYSCTRQ QNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGR MSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSR GADTLTYTLGLSDGQLPLGASPDLPEASACPPGLL RASGSGPPYSNTLAKTEVQGASCHLEYSPERGKAE GRDSIYSTDGQLTLGRCGLRFEETRHPELGEPEQG PDSHCIPSFCSAPEVPYASLTDIEYLVQNVCKSFR ETCQLRLEDLLRQRTNLFSREEVTSYQRKSMWEMW ERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIIL LTAGAMEVVLVRMCRAYNANNHTVFFEGKYGGVEL FRALGCSELISSIFDFSHFLSALCFSEDEIALYTA LVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKT HRQGLLAKLPPKGKLRSLCSQHVEKLQIFQHLHPI VVQAAFPPLYKELFSTDVESPEGLSK
Expression Region
1-516aa
Sequence Info
Full Length
Source
Yeast
Tag Info
N-terminal 6xHis-tagged
MW
60.1 kDa
Alternative Name(s)
Nuclear receptor RZR-gamma
Nuclear receptor subfamily 1 group F member 3
RAR-related orphan receptor C
Retinoid-related orphan receptor-gamma
Thymus orphan receptor
Short name:
TOR
Relevance
Nuclear receptor that binds DNA as a monomer to ROR response elements (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Key regulator of cellular differentiation, immunity, peripheral circadian rhythm as well as lipid, steroid, xenobiotics and glucose metabolism. Considered to have intrinsic transcriptional activity, have some natural ligands like oxysterols that act as agonists (25-hydroxycholesterol) or inverse agonists (7-oxygenated sterols), enhancing or repressing the transcriptional activity, respectively. Recruits distinct combinations of cofactors to target gene regulatory regions to modulate their transcriptional expression, depending on the tissue, time and promoter contexts (PubMed:17666523, PubMed:19381306, PubMed:19965867, PubMed:21853531, PubMed:22789990, PubMed:23723244). Regulates the circadian expression of clock genes such as CRY1, ARNTL/BMAL1 and NR1D1 in peripheral tissues and in a tissue-selective manner (PubMed:22753030). Competes with NR1D1 for binding to their shared DNA response element on some clock genes such as ARNTL/BMAL1, CRY1 and NR1D1 itself, resulting in NR1D1-mediated repression or RORC-mediated activation of the expression, leading to the circadian pattern of clock genes expression. Therefore influences the period length and stability of the clock (PubMed:22753030). Involved in the regulation of the rhythmic expression of genes involved in glucose and lipid metabolism, including PLIN2 and AVPR1A. Negative regulator of adipocyte differentiation through the regulation of early phase genes expression, such as MMP3. Controls adipogenesis as well as adipocyte size and modulates insulin sensitivity in obesity. In liver, has specific and redundant functions with RORA as positive or negative modulator of expression of genes encoding phase I and Phase II proteins involved in the metabolism of lipids, steroids and xenobiotics, such as SULT1E1 (PubMed:21853531). Also plays also a role in the regulation of hepatocyte glucose metabolism through the regulation of G6PC and PCK1. Regulates the rhythmic expression of PROX1 and promotes its nuclear localization.
Reference
"Gene expression profiling reveals a regulatory role for ROR alpha and ROR gamma in phase I and phase II metabolism."Kang H.S., Angers M., Beak J.Y., Wu X., Gimble J.M., Wada T., Xie W., Collins J.B., Grissom S.F., Jetten A.M.Physiol. Genomics 31:281-294(2007).
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Nuclear receptor that binds DNA as a monomer to ROR response elements (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Key regulator of cellular differentiation, immunity, peripheral circadian rhythm as well as lipid, steroid, xenobiotics and glucose metabolism. Considered to have intrinsic transcriptional activity, have some natural ligands like oxysterols that act as agonists (25-hydroxycholesterol) or inverse agonists (7-oxygenated sterols), enhancing or repressing the transcriptional activity, respectively. Recruits distinct combinations of cofactors to target gene regulatory regions to modulate their transcriptional expression, depending on the tissue, time and promoter contexts
Subcellular Location
Nucleus
Protein Families
Nuclear hormone receptor family, NR1 subfamily
Tissue Specificity
Isoform 1 is widely expressed with highest levels in muscle, kidney and liver. Isoform 2 is expressed primarily in immature thymocytes and the subset of mature T(H)17 cells. Neither isoform is expressed in spleen or bone marrow.
Tag Information
N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen