« Zurück
Home /
Recombinant Human N-glycosylase/DNA lyase(OGG1)

Recombinant Human N-glycosylase/DNA lyase(OGG1)

ArtNr	CSB-YP016313HU-500
Hersteller	Cusabio
Menge	500ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	8-oxoguanine DNA glycosylase (EC:3.2.2.-),DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18),Short name:,AP lyase
Lieferbar
Research Areas	Cancer
Uniprot ID	O15527
Gene Names	OGG1
Organism	Homo sapiens (Human)
AA Sequence	MPARALLPRRMGHRTLASTPALWASIPCPRSELRL DLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTE EQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVT LAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDPIEC LFSFICSSNNNIARITGMVERLCQAFGPRLIQLDD VTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSA SARAILEEQGGLAWLQQLRESSYEEAHKALCILPG VGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYS WHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQ AVLFSADLRQSRHAQEPPAKRRKGSKGPEG
Expression Region	1-345aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	40.8 kDa
Alternative Name(s)	8-oxoguanine DNA glycosylase (EC:3.2.2.-) DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18) Short name: AP lyase
Relevance	DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7, 8-dihydro-8-oxoguanine and 2, 6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion.
Reference	Cloning and characterization of mammalian 8-hydroxyguanine-specific DNA glycosylase/apurinic, apyrimidinic lyase, a functional mutM homologue.Aburatani H., Hippo Y., Ishida T., Takashima R., Matsuba C., Kodama T., Takao M., Yasui A., Yamamoto K., Asano M., Fukasawa K., Yoshinari T., Inoue H., Otsuka E., Nishimura S.Cancer Res. 57:2151-2156(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7, 8-dihydro-8-oxoguanine and 2, 6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion.
Involvement in disease	Renal cell carcinoma (RCC)
Subcellular Location	Nucleus, nucleoplasm, Nucleus speckle, Nucleus matrix
Protein Families	Type-1 OGG1 family
Tissue Specificity	Ubiquitous.
Paythway	DNArepairpathway
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen