« Zurück
Home /
Recombinant Human Tyrosine-protein kinase JAK1(JAK1),partial

Recombinant Human Tyrosine-protein kinase JAK1(JAK1),partial

Hersteller	Cusabio
Kategorie	Oncology Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins By Organ Colorectal Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	Yeast
ArtNr	CSB-YP011930HU-200
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Alias	Janus kinase 1,Short name:,JAK-1
Purity	Greater than 90% as determined by SDS-PAGE.
Research Topic	Cancer
Uniprot ID	P23458
Gene Names	JAK1
Organism	Homo sapiens (Human)
AA Sequence	EQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEG HFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHI ADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKL IMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICK GMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGL TKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFY IASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGP THGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMR KCWEFQPSNRTSFQNLIEGFEALLK
Expression Region	850-1154aa
Sequence Info	Partial
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	36.9 kDa
Alternative Name(s)	Janus kinase 1 Short name: JAK-1
Relevance	Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor.
Reference	"Two novel protein-tyrosine kinases, each with a second phosphotransferase-related catalytic domain, define a new class of protein kinase." Wilks A.F., Harpur A.G., Kurban R.R., Ralph S.J., Zuercher G., Ziemiecki A.Mol. Cell. Biol. 11:2057-2065(1991)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway
Subcellular Location	Endomembrane system, Peripheral membrane protein
Protein Families	Protein kinase superfamily, Tyr protein kinase family, JAK subfamily
Tissue Specificity	Expressed at higher levels in primary colon tumors than in normal colon tissue. The expression level in metastatic colon tumors is comparable to the expression level in normal colon tissue.
Paythway	Jak-STATsignalingpathway
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen