« Zurück
Home /
Recombinant Marmota monax Interferon gamma(IFNG)

Recombinant Marmota monax Interferon gamma(IFNG)

ArtNr	CSB-YP011050MQG-1
Hersteller	Cusabio
Menge	1mg
Kategorie	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Short name:,IFN-gamma
Lieferbar
Research areas	Stem Cells
Target / Protein	IFNG
Biologically active	Not Test
Expression system	Yeast
Species of origin	Marmota monax (Woodchuck)
Uniprot ID	O35735
AA Sequence	QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDK WKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSM DTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKI QRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRR ASK
Tag Info	N-terminal 6xHis-tagged
Expression Region	24-166aa
Protein length	Full Length of Mature Protein
MW	18.6 kDa
Alternative Name(s)	Short name: IFN-gamma
Relevance	Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
References	"Molecular cloning of the woodchuck cytokines: TNF-alpha, IFN-gamma, and IL-6."Lohrengel B., Lu M., Roggendorf M.Immunogenetics 47:332-335(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Subcellular Location	Secreted
Protein Families	Type II (or gamma) interferon family
Tissue Specificity	Released primarily from activated T lymphocytes.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen