« Zurück
Home /
Recombinant Helicobacter pylori Bacterial non-heme ferritin(ftnA)

Recombinant Helicobacter pylori Bacterial non-heme ferritin(ftnA)

ArtNr	CSB-YP009053HUV-500
Hersteller	Cusabio
Menge	500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Areas	Others
Uniprot ID	P52093
Gene Names	ftnA
Organism	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
AA Sequence	MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHS LDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQL TSISAPEHKFEGLTQIFQKAYEHEQHISESINNIV DHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDK IELIGNENHGLYLADQYVKGIAKSRKS
Expression Region	1-167aa
Sequence Info	Full length
Source	Yeast
Tag Info	N-terminal 10xHis-tagged
MW	21.8 kDa
Alternative Name(s)	pfr
Relevance	Iron-storage protein.
Reference	Paracrystalline inclusions of a novel ferritin containing nonheme iron, produced by the human gastric pathogen Helicobacter pylori: evidence for a third class of ferritins. Frazier B.A., Pfeifer J.D., Russell D.G., Falk P., Olsen A.N., Hammar M., Westblom T.U., Normark S.J. J. Bacteriol. 175:966-972(1993)
Purity	Greater than 85% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Iron-storage protein.
Subcellular Location	Cytoplasm
Protein Families	Ferritin family, Prokaryotic subfamily
Tag Information	N-terminal 10xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen