« Zurück
Home /
Recombinant Human Endothelin-1 receptor(EDNRA) ,partial

Recombinant Human Endothelin-1 receptor(EDNRA) ,partial

ArtNr	CSB-YP007403HU1-100
Hersteller	Cusabio
Menge	100ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Human
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Endothelin A receptor ;ET-A ;ETA-R ;hET-AR
Lieferbar
Research Areas	Signal Transduction
Target / Protein	EDNRA
Biologically Active	Not Test
Expression System	Yeast
Species of origin	Homo sapiens (Human)
Uniprot ID	P25101
AA Sequence	DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPT NLVLPSNGSMHNYCPQQTKITSAFK
Tag Info	N-terminal 6xHis-tagged
Expression Region	21-80aa
Protein Length	Partial
MW	8.8 kDa
Alternative Name(s)	Endothelin A receptor ; ET-A ; ETA-R ; hET-AR
Relevance	Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger syst. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
Reference	Cloning and characterization of cDNA encoding human A-type endothelin receptor.Adachi M., Yang Y.Y., Furuichi Y., Miyamoto C.Biochem. Biophys. Res. Commun. 180:1265-1272(1991)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is
Involvement in disease	Mandibulofacial dysostosis with alopecia (MFDA)
Subcellular Location	Cell membrane, Multi-pass membrane protein
Protein Families	G-protein coupled receptor 1 family, Endothelin receptor subfamily, EDNRA sub-subfamily
Tissue Specificity	Isoform 1, isoform 3 and isoform 4 are expressed in a variety of tissues, with highest levels in the aorta and cerebellum, followed by lung, atrium and cerebral cortex, lower levels in the placenta, kidney, adrenal gland, duodenum, colon, ventricle and liver but no expression in umbilical vein endothelial cells. Within the placenta, isoform 1, isoform 2, isoform 3 and isoform 4 are expressed in the villi and stem villi vessels.
Paythway	Calciumsignalingpathway
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP007403HU1-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen