ArtNr |
CSB-YP007403HU1-100 |
Hersteller |
Cusabio
|
Menge |
100ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
Human |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Endothelin A receptor ;ET-A ;ETA-R ;hET-AR |
Lieferbar |
|
Research Areas |
Signal Transduction |
Target / Protein |
EDNRA |
Biologically Active |
Not Test |
Expression System |
Yeast |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P25101 |
AA Sequence |
DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPT NLVLPSNGSMHNYCPQQTKITSAFK |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
21-80aa |
Protein Length |
Partial |
MW |
8.8 kDa |
Alternative Name(s) |
Endothelin A receptor ; ET-A ; ETA-R ; hET-AR |
Relevance |
Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger syst. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3. |
Reference |
Cloning and characterization of cDNA encoding human A-type endothelin receptor.Adachi M., Yang Y.Y., Furuichi Y., Miyamoto C.Biochem. Biophys. Res. Commun. 180:1265-1272(1991) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is |
Involvement in disease |
Mandibulofacial dysostosis with alopecia (MFDA) |
Subcellular Location |
Cell membrane, Multi-pass membrane protein |
Protein Families |
G-protein coupled receptor 1 family, Endothelin receptor subfamily, EDNRA sub-subfamily |
Tissue Specificity |
Isoform 1, isoform 3 and isoform 4 are expressed in a variety of tissues, with highest levels in the aorta and cerebellum, followed by lung, atrium and cerebral cortex, lower levels in the placenta, kidney, adrenal gland, duodenum, colon, ventricle and liver but no expression in umbilical vein endothelial cells. Within the placenta, isoform 1, isoform 2, isoform 3 and isoform 4 are expressed in the villi and stem villi vessels. |
Paythway |
Calciumsignalingpathway |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.