« Zurück
Home /
Recombinant Human D-amino-acid oxidase(DAO)

Recombinant Human D-amino-acid oxidase(DAO)

ArtNr	CSB-YP006494HU-1
Hersteller	Cusabio
Menge	1mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Short name:,DAAO,Short name:,DAMOX,Short name:,DAO
Lieferbar
Research Topic	Metabolism
Uniprot ID	P14920
Gene Names	DAO
Organism	Homo sapiens (Human)
AA Sequence	MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVY ADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQ TFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDP SWKDTVLGFRKLTPRELDMFPDYGYGWFHTSLILE GKNYLQWLTERLTERGVKFFQRKVESFEEVAREGA DVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWM KHFILTHDPERGIYNSPYIIPGTQTVTLGGIFQLG NWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERT GFRPVRPQIRLEREQLRTGPSNTEVIHNYGHGGYG LTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
Expression Region	1-347aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	41.5 kDa
Alternative Name(s)	Short name: DAAO Short name: DAMOX Short name: DAO
Relevance	Regulates the level of the neuromodulator D-serine in the brain. Has high activity towards D-DOPA and contributes to dopamine synthesis. Could act as a detoxifying agent which removes D-amino acids accumulated during aging. Acts on a variety of D-amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids.
Reference	"Complete sequencing and characterization of 21, 243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Regulates the level of the neuromodulator D-serine in the brain. Has high activity towards D-DOPA and contributes to dopamine synthesis. Could act as a detoxifying agent which removes D-amino acids accumulated during aging. Acts on a variety of D-amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids.
Involvement in disease	Schizophrenia (SCZD)
Subcellular Location	Peroxisome
Protein Families	DAMOX/DASOX family
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP006494HU-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen