« Zurück
Home /
Recombinant Mouse Cytochrome P450 2E(Cyp2e1)

Recombinant Mouse Cytochrome P450 2E(Cyp2e1)

ArtNr	CSB-YP006425MO-1
Hersteller	Cusabio
Menge	1mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	4-nitrophenol 2-hydroxylase (EC:1.14.13.n7),CYPIIE1,Cytochrome P450-ALC,Cytochrome P450-J
Lieferbar
Research Areas	Others
Uniprot ID	Q05421
Gene Names	Cyp2e1
Organism	Mus musculus (Mouse)
AA Sequence	AVLGITVALLVWIATLLLVSIWKQIYRSWNLPPGP FPIPFFGNIFQLDLKDIPKSLTKLAKRFGPVFTLH LGQRRIVVLHGYKAVKEVLLNHKNEFSGRGDIPVF QEYKNKGIIFNNGPTWKDVRRFSLSILRDWGMGKQ GNEARIQREAHFLVEELKKTKGQPFDPTFLIGCAP CNVIADILFNKRFDYDDKKCLELMSLFNENFYLLS TPWIQAYNYFSDYLQYLPGSHRKVMKNVSEIRQYT LGKAKEHLKSLDINCPRDVTDCLLIEMEKEKHSQE PMYTMENISVTLADLFFAGTETTSTTLRYGLLILM KYPEIEEKLHEEIDRVIGPSRAPAVRDRMNMPYMD AVVHEIQRFINLVPSNLPHEATRDTVFRGYVIPKG TVVIPTLDSLLFDNYEFPDPETFKPEHFLNENGKF KYSDYFKAFSAGKRVCVGEGLARMELFLLLSAILQ HFNLKSLVDPKDIDLSPVTIGFGSIPREFKLCVIP RS
Expression Region	2-493aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	58.7 kDa
Alternative Name(s)	4-nitrophenol 2-hydroxylase (EC:1.14.13.n7) CYPIIE1 Cytochrome P450-ALC Cytochrome P450-J
Relevance	Metabolizes several precarcinogens, drugs, and solvents to reactive metabolites.
Reference	The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Metabolizes several precarcinogens, drugs, and solvents to reactive metabolites.
Subcellular Location	Endoplasmic reticulum membrane, Peripheral membrane protein, Microsome membrane, Peripheral membrane protein
Protein Families	Cytochrome P450 family
Tissue Specificity	Highest level in the liver and to a lesser extent in the kidney, with a higher level in the male kidney than in the female.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen