« Zurück
Home /
Recombinant Human Connector enhancer of kinase suppressor of ras 2(CNKSR2),partial

Recombinant Human Connector enhancer of kinase suppressor of ras 2(CNKSR2),partial

ArtNr	CSB-YP005653HU-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CNK homolog protein 2 ;CNK2
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	Q8WXI2
Gene Names	CNKSR2
Organism	Homo sapiens (Human)
AA Sequence	AAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYW SESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCA SPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSA VSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPL EDSVFSDSAAI
Expression Region	650-800aa
Sequence Info	Partial
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	19.1 kDa
Alternative Name(s)	CNK homolog protein 2 ; CNK2
Relevance	May function as an adapter protein or regulator of Ras signaling pathways.
Reference	Human homologue of Drosophila CNK interacts with Ras effector proteins Raf and Rlf.Lanigan T.M., Liu A., Huang Y.Z., Mei L., Margolis B., Guan K.-L.FASEB J. 17:2048-2060(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May function as an adapter protein or regulator of Ras signaling pathways.
Subcellular Location	Cytoplasm, Membrane, Peripheral membrane protein
Protein Families	CNKSR family
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen