« Zurück
Home /
Recombinant Mouse Acetylcholine receptor subunit alpha(Chrna1),partial

Recombinant Mouse Acetylcholine receptor subunit alpha(Chrna1),partial

ArtNr	CSB-YP005386MO-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Others
Uniprot ID	P04756
Gene Names	Chrna1
Organism	Mus musculus (Mouse)
AA Sequence	SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGL QLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPD DYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKF TKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQ NCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGE WVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL
Expression Region	21-230aa
Sequence Info	Extracellular Domain
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	26.5 kDa
Relevance	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma mbrane.
Reference	Nucleotide sequence of the mouse muscle nicotinic acetylcholine receptor alpha subunit.Isenberg K.E., Mudd J., Shah V., Merlie J.P.Nucleic Acids Res. 14:5111-5111(1986)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Subcellular Location	Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Protein Families	Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-1/CHRNA1 sub-subfamily
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP005386MO-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen