ArtNr |
CSB-YP005383HU-200 |
Hersteller |
Cusabio
|
Menge |
200ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Yeast |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research Topic |
Neuroscience |
Uniprot ID |
P20309 |
Gene Names |
CHRM3 |
Organism |
Homo sapiens (Human) |
AA Sequence |
RIYKETEKRTKELAGLQASGTEAETENFVHPTGSS RSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKP SSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDI GSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVP EEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKL PIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEAT LAKRFALKTRSQITKRKRMSLVKEKKAAQT |
Expression Region |
253-492aa |
Sequence Info |
Cytoplasmic Domain |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
28.7 kDa |
Relevance |
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover. |
Reference |
Distinct primary structures, ligand-binding properties and tissue-specific expression of four human muscarinic acetylcholine receptors.Peralta E.G., Ashkenazi A., Winslow J.W., Smith D.H., Ramachandran J., Capon D.J.EMBO J. 6:3923-3929(1987) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover. |
Involvement in disease |
Prune belly syndrome (PBS) |
Subcellular Location |
Cell membrane, Multi-pass membrane protein, Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Basolateral cell membrane, Multi-pass membrane protein |
Protein Families |
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM3 sub-subfamily |
Paythway |
Calciumsignalingpathway |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.