« Zurück
Home /
Recombinant Human ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1(CD38),partial

Recombinant Human ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1(CD38),partial

ArtNr	CSB-YP004929HU1c7-500
Hersteller	Cusabio
Menge	500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Cancer
Target / Protein	CD38
Biologically active	Not Test
Expression system	Yeast
Species of origin	Homo sapiens (Human)
Uniprot ID	P28907
AA Sequence	VPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEM RHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKL GTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLED TLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSN NPVSVFWKTVSRRFAEAACDVVHVMLNGSRSKIFD KNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRD LCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQC VKNPEDSSCTSEI
Tag Info	C-terminal 6xHis-tagged
Expression Region	43-300aa
Protein length	Partial
MW	30.7 kDa
Alternative Name(s)	2'-phospho-ADP-ribosyl cyclase (2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase (EC:2.4.99.20)) (2'-phospho-cyclic-ADP-ribose transferase) (ADP-ribosyl cyclase 1) (ADPRC 1) (Cyclic ADP-ribose hydrolase 1) (cADPr hydrolase 1) (T10) (CD_antigen: CD38)
Relevance	Synthesizes the second messagers cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate, the former a second messenger for glucose-induced insulin secretion. Also has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system.
References	"Human gene encoding CD38 (ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase): organization, nucleotide sequence and alternative splicing." Nata K., Takamura T., Karasawa T., Kumagai T., Hashioka W., Tohgo A., Yonekura H., Takasawa S., Nakamura S., Okamoto H. Gene 186:285-292(1997)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Synthesizes the second messagers cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate, the former a second messenger for glucose-induced insulin secretion. Also has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system.
Subcellular Location	Membrane, Single-pass type II membrane protein
Protein Families	ADP-ribosyl cyclase family
Tissue Specificity	Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma.
Paythway	Calciumsignalingpathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen