ArtNr |
CSB-YP002853HU-10 |
Hersteller |
Cusabio
|
Menge |
10ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Lieferbar |
|
Research Topic |
Signal Transduction |
Uniprot ID |
P35070 |
Gene Names |
BTC |
Organism |
Homo sapiens (Human) |
AA Sequence |
DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHF SRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIG ARCERVDLFYLRGDRGQILVICLIAVMVVFIILVI GVCTCCHPLRKRRKRKKKEEEMETLGKDITPINED IEETNIA |
Expression Region |
32-178aa |
Sequence Info |
Full Length of Mature Protein |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
18.6 kDa |
Relevance |
Growth factor that binds to EGFR, ERBB4 and other EGF receptor family mbers. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. |
Reference |
Cloning and expression of cDNA encoding human betacellulin, a new member of the EGF family.Sasada R., Ono Y., Taniyama Y., Shing Y., Folkman J., Igarashi K.Biochem. Biophys. Res. Commun. 190:1173-1179(1993) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. |
Subcellular Location |
Betacellulin: Secreted, extracellular space, SUBCELLULAR LOCATION: Probetacellulin: Cell membrane, Single-pass type I membrane protein |
Tissue Specificity |
Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine. |
Paythway |
ErbBsignalingpathway |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.