« Zurück
Home /
Recombinant Human Probetacellulin(BTC)

Recombinant Human Probetacellulin(BTC)

ArtNr	CSB-YP002853HU-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Oncology Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins By Organ Skin Cancer Bladder Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	P35070
Gene Names	BTC
Organism	Homo sapiens (Human)
AA Sequence	DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHF SRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIG ARCERVDLFYLRGDRGQILVICLIAVMVVFIILVI GVCTCCHPLRKRRKRKKKEEEMETLGKDITPINED IEETNIA
Expression Region	32-178aa
Sequence Info	Full Length of Mature Protein
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	18.6 kDa
Relevance	Growth factor that binds to EGFR, ERBB4 and other EGF receptor family mbers. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.
Reference	Cloning and expression of cDNA encoding human betacellulin, a new member of the EGF family.Sasada R., Ono Y., Taniyama Y., Shing Y., Folkman J., Igarashi K.Biochem. Biophys. Res. Commun. 190:1173-1179(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.
Subcellular Location	Betacellulin: Secreted, extracellular space, SUBCELLULAR LOCATION: Probetacellulin: Cell membrane, Single-pass type I membrane protein
Tissue Specificity	Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine.
Paythway	ErbBsignalingpathway
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen