« Zurück
Home /
Recombinant Mouse Apolipoprotein A-IV(Apoa4)

Recombinant Mouse Apolipoprotein A-IV(Apoa4)

ArtNr	CSB-YP001916MO-100
Hersteller	Cusabio
Menge	100ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Kategorie	Neuroscience Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Mouse
Host	Yeast
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Apolipoprotein A4
Lieferbar
Research Areas	Others
Target / Protein	Apoa4
Biologically Active	Not Test
Expression System	Yeast
Species of origin	Mus musculus (Mouse)
Uniprot ID	P06728
AA Sequence	EVTSDQVANVVWDYFTQLSNNAKEAVEQFQKTDVT QQLSTLFQDKLGDASTYADGVHNKLVPFVVQLSGH LAQETERVKEEIKKELEDLRDRMMPHANKVTQTFG ENMQKLQEHLKPYAVDLQDQINTQTQEMKLQLTPY IQRMQTTIKENVDNLHTSMMPLATNLKDKFNRNME ELKGHLTPRANELKATIDQNLEDLRRSLAPLTVGV QEKLNHQMEGLAFQMKKNAEELQTKVSAKIDQLQK NLAPLVEDVQSKVKGNTEGLQKSLEDLNRQLEQQV EEFRRTVEPMGEMFNKALVQQLEQFRQQLGPNSGE VESHLSFLEKSLREKVNSFMSTLEKKGSPDQPQAL PLPEQAQEQAQEQAQEQVQPKPLES
Tag Info	N-terminal 6xHis-tagged
Expression Region	21-395aa
Protein Length	Full Length of Mature Protein
MW	45 kDa
Alternative Name(s)	Apolipoprotein A4
Relevance	May have a role in chylomicrons and VLDL secretion and catabolism. Required for efficient activation of lipoprotein lipase by ApoC-II; potent activator of LCAT. Apoa-IV is a major component of HDL and chylomicrons.
Reference	Mass spectral analysis of the apolipoproteins on mouse high density lipoproteins. Detection of post-translational modifications.Puppione D.L., Yam L.M., Bassilian S., Souda P., Castellani L.W., Schumaker V.N., Whitelegge J.P.Biochim. Biophys. Acta 1764:1363-1371(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May have a role in chylomicrons and VLDL secretion and catabolism. Required for efficient activation of lipoprotein lipase by ApoC-II; potent activator of LCAT. Apoa-IV is a major component of HDL and chylomicrons.
Subcellular Location	Secreted
Protein Families	Apolipoprotein A1/A4/E family
Tissue Specificity	Secreted in plasma.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP001916MO-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen