« Zurück
Home /
Recombinant Escherichia coli NAD(P)H-flavin reductase(fre)

Recombinant Escherichia coli NAD(P)H-flavin reductase(fre)

ArtNr	CSB-RP185374Ba-200
Hersteller	Cusabio
Menge	200ug
Quantity options	1mg 10ug 100ug 200ug 20ug 50ug 500ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Aquacobalamin reductaseFMN reductaseFerrisiderophore reductase CNAD(P)H:flavin oxidoreductaseRiboflavin reductase [NAD(P)H]
Lieferbar
Research Areas	Others
Target / Protein	fre
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Escherichia coli (strain K12)
Uniprot ID	P0AEN1
AA Sequence	TTLSCKVTSVEAITDTVYRVRIVPDAAFSFRAGQY LMVVMDERDKRPFSMASTPDEKGFIELHIGASEIN LYAKAVMDRILKDHQIVVDIPHGEAWLRDDEERPM ILIAGGTGFSYARSILLTALARNPNRDITIYWGGR EEQHLYDLCELEALSLKHPGLQVVPVVEQPEAGWR GRTGTVLTAVLQDHGTLAEHDIYIAGRFEMAKIAR DLFCSERNAREDRLFGDAFAFI
Tag Info	N-terminal 6xHis-tagged
Expression Region	2-233aa
Protein Length	Full Length of Mature Protein
MW	30.1 kDa
Alternative Name(s)	Aquacobalamin reductaseFMN reductaseFerrisiderophore reductase CNAD(P)H:flavin oxidoreductaseRiboflavin reductase [NAD(P)H]
Relevance	Catalyzes the reduction of soluble flavins by reduced pyridine nucleotides. Ses to reduce the complexed Fe3+ iron of siderophores to Fe2+, thus releasing it from the chelator.
Reference	Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the reduction of soluble flavins by reduced pyridine nucleotides. Seems to reduce the complexed Fe(3+) iron of siderophores to Fe(2+), thus releasing it from the chelator.
Protein Families	Fre/LuxG FAD/NAD(P) flavoprotein oxidoreductase family
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen