« Zurück
Home /
Recombinant Human Creatine kinase U-type, mitochondrial(CKMT1A)

Recombinant Human Creatine kinase U-type, mitochondrial(CKMT1A)

ArtNr	CSB-RP098174h-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Acidic-type mitochondrial creatine kinase ;Mia-CKUbiquitous mitochondrial creatine kinase ;U-MtCK
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	P12532
Gene Names	CKMT1A
Organism	Homo sapiens (Human)
AA Sequence	ASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYAR LCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVA GDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDL DASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPAC TRAERREVERVVVDALSGLKGDLAGRYYRLSEMTE AEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARG IWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFE RFCRGLKEVERLIQERGWEFMWNERLGYILTCPSN LGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRG TGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDG VNYLIDCERRLERGQDIRIPTPVIHTKH
Expression Region	40-417aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	47.1 kDa
Alternative Name(s)	Acidic-type mitochondrial creatine kinase ; Mia-CKUbiquitous mitochondrial creatine kinase ; U-MtCK
Relevance	Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy dands, such as skeletal muscle, heart, brain and spermatozoa.
Reference	Isolation and characterization of the gene and cDNA encoding human mitochondrial creatine kinase.Haas R.C., Korenfeld C., Zhang Z., Perryman B., Roman D., Strauss A.W.J. Biol. Chem. 264:2890-2897(1989)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
Subcellular Location	Mitochondrion inner membrane, Peripheral membrane protein, Intermembrane side
Protein Families	ATP:guanido phosphotransferase family
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen