« Zurück
Home /
Recombinant Human LIM and SH3 domain protein 1(LASP1),partial

Recombinant Human LIM and SH3 domain protein 1(LASP1),partial

ArtNr	CSB-RP046244h-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins By Organ Breast Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Metastatic lymph node gene 50 protein ;MLN 50
Lieferbar
Research Topic	Transport
Uniprot ID	Q14847
Gene Names	LASP1
Organism	Homo sapiens (Human)
AA Sequence	MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETC KMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPE NLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTP ELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGME PERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQ QQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAV YDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGT
Expression Region	1-243aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	54.8 kDa
Alternative Name(s)	Metastatic lymph node gene 50 protein ; MLN 50
Relevance	Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types .
Reference	Identification of four novel human genes amplified and overexpressed in breast carcinoma and localized to the q11-q21.3 region of chromosome 17.Tomasetto C.L., Regnier C.H., Moog-Lutz C., Mattei M.-G., Chenard M.-P., Lidereau R., Basset P., Rio M.-C.Genomics 28:367-376(1995)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types (By similarity).
Subcellular Location	Cytoplasm, cell cortex, Cytoplasm, cytoskeleton
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen