ArtNr |
CSB-MP012911HU-50 |
Hersteller |
Cusabio
|
Menge |
50ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
Mammalian cells |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Luteinizing hormone receptor,Short name:,LHR,Short name:,LSH-R |
Lieferbar |
|
Research Topic |
Cardiovascular |
Uniprot ID |
P22888 |
Gene Names |
LHCGR |
Organism |
Homo sapiens (Human) |
AA Sequence |
EALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLPV KVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDN LLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSIC NTGIRKFPDVTKVFSSESNFILEICDNLHITTIPG NAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTS LELKENVHLEKMHNGAFRGATGPKTLDISSTKLQA LPSYGLESIQRLIATSSYSLKKLPSRETFVNLLEA TLTYPSHCCAFRNLPTKEQNFSHSISENFSKQCES TVRKVNNKTLYSSMLAESELSGWDYEYGFCLPKTP RCAPEPDAFNPCEDIMGYDFL |
Expression Region |
27-362aa |
Sequence Info |
Full Length of Mature Protein |
Source |
Mammalian cell |
Tag Info |
N-terminal 6xHis-tagged |
MW |
41.4 kDa |
Alternative Name(s) |
Luteinizing hormone receptor Short name: LHR Short name: LSH-R |
Relevance |
Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. |
Reference |
"Cloning and sequencing of human LH/hCG receptor cDNA."Minegish T., Nakamura K., Takakura Y., Miyamoto K., Hasegawa Y., Ibuki Y., Igarashi M.Biochem. Biophys. Res. Commun. 172:1049-1054(1990) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Receptor for lutropin-choriogonadotropic hormone |
Involvement in disease |
Familial male precocious puberty (FMPP); Luteinizing hormone resistance (LHR) |
Subcellular Location |
Cell membrane, Multi-pass membrane protein |
Protein Families |
G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily |
Tissue Specificity |
Gonadal and thyroid cells. |
Paythway |
Calciumsignalingpathway |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.