« Zurück
Home /
Recombinant Human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform(PPP2R2C)

Recombinant Human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform(PPP2R2C)

ArtNr	CSB-EP897535HU-200
Hersteller	Cusabio
Menge	200ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Research areas	Signal Transduction
Target / Protein	PPP2R2C
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	Q9Y2T4
AA Sequence	MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHT GELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY STFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAH SLLSTNDKTIKLWKITERDKRPEGYNLKDEEGKLK DLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYH INSISVNSDCETYMSADDLRINLWHLAITDRSFNI VDIKPANMEDLTEVITASEFHPHHCNLFVYSSSKG SLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEI ISSVSDVKFSHSGRYMLTRDYLTVKVWDLNMEARP IETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSD SVIMTGAYNNFFRMFDRNTKRDVTLEASRESSKPR AVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAW HPAENIIAIAATNNLYIFQDKVNSDMH
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region	1-447aa
Protein length	Full Length
MW	58.5 kDa
Alternative Name(s)	IMYPNO1 (PP2A subunit B isoform B55-gamma) (PP2A subunit B isoform PR55-gamma) (PP2A subunit B isoform R2-gamma) (PP2A subunit B isoform gamma)
Relevance	The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
References	"Molecular cloning and mapping of the brain-abundant B1gamma subunit of protein phosphatase 2A, PPP2R2C, to human chromosome 4p16." Hu P., Yu L., Zhang M., Zheng L., Zhao Y., Fu Q., Zhao S. Genomics 67:83-86(2000)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
Protein Families	Phosphatase 2A regulatory subunit B family
Paythway	Hipposignalingpathway
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen