ArtNr |
CSB-EP897459HU-10 |
Hersteller |
Cusabio
|
Menge |
10ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
48 kDa TATA box-binding protein-interacting protein,Short name:,48 kDa TBP-interacting protein,51 kDa erythrocyte cytosolic protein,Short name:,ECP-51,INO80 complex subunit J,Repressing pontin 52,Short name:,Reptin 52,TIP49b,TIP60-associated protein 54-be |
Lieferbar |
|
Research areas |
Epigenetics and Nuclear Signaling |
Target / Protein |
RUVBL2 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
Q9Y230 |
AA Sequence |
ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDA LEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGR AVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGS EIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGE VVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGT KMIESLTKDKVQAGDVITIDKATGKISKLGRSFTR ARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHE IDVINSRTQGFLALFSGDTGEIKSEVREQINAKVA EWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRAL ESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLL DRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDA YTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEV QVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELK GETMDTS |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
2-463aa |
Protein length |
Full Length of Mature Protein |
MW |
67 kDa |
Alternative Name(s) |
48 kDa TATA box-binding protein-interacting protein Short name: 48 kDa TBP-interacting protein 51 kDa erythrocyte cytosolic protein Short name: ECP-51 INO80 complex subunit J Repressing pontin 52 Short name: Reptin 52 TIP49b TIP60-associated protein 54-beta Short name: TAP54-beta |
Relevance |
Possesses single-stranded DNA-stimulated ATPase and ATP-dependent DNA helicase (5' to 3') activity; hexamerization is thought to be critical for ATP hydrolysis and adjacent subunits in the ring-like structure contribute to the ATPase activity. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome. Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. Plays an essential role in oncogenic transformation by MYC and also modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex. May also inhibit the transcriptional activity of ATF2. Involved in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway where it negatively regulates expression of ER stress response genes. |
References |
"Genome-wide screen identifies a novel p97/CDC-48-dependent pathway regulating ER-stress-induced gene transcription."Marza E., Taouji S., Barroso K., Raymond A.A., Guignard L., Bonneu M., Pallares-Lupon N., Dupuy J.W., Fernandez-Zapico M.E., Rosenbaum J., Palladino F., Dupuy D., Chevet E.EMBO Rep. 16:332-340(2015) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Possesses single-stranded DNA-stimulated ATPase and ATP-dependent DNA helicase (5' to 3') activity; hexamerization is thought to be critical for ATP hydrolysis and adjacent subunits in the ring-like structure contribute to the ATPase activity.; FUNCTION |
Subcellular Location |
Nucleus matrix, Nucleus, nucleoplasm, Cytoplasm, Membrane |
Protein Families |
RuvB family |
Tissue Specificity |
Ubiquitously expressed. Highly expressed in testis and thymus. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.