« Zurück
Home /
Recombinant Mouse 2-Hydroxyacid oxidase 1(Hao1)

Recombinant Mouse 2-Hydroxyacid oxidase 1(Hao1)

ArtNr	CSB-EP894819MO-10
Hersteller	Cusabio
Menge	10ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Short name:,HAOX1,Alternative name(s):,Glycolate oxidase,Short name:,GOX
Lieferbar
Research areas	Tags & Cell Markers
Target / Protein	Hao1
Biologically active	Not Test
Expression system	E.coli
Species of origin	Mus musculus (Mouse)
Uniprot ID	Q9WU19
AA Sequence	MLPRLVCISDYEQHVRSVLQKSVYDYYRSGANDQE TLADNIQAFSRWKLYPRMLRNVADIDLSTSVLGQR VSMPICVGATAMQCMAHVDGELATVRACQTMGTGM MLSSWATSSIEEVAEAGPEALRWMQLYIYKDREIS RQIVKRAEKQGYKAIFVTVDTPYLGNRIDDVRNRF KLPPQLRMKNFETNDLAFSPKGNFGDNSGLAEYVA QAIDPSLSWDDITWLRRLTSLPIVVKGILRGDDAK EAVKHGVDGILVSNHGARQLDGVPATIDVLPEIVE AVEGKVEVFLDGGVRKGTDVLKALALGAKAVFVGR PIIWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQ NVKVIDKTLVRKNPLAVSKI
Tag Info	N-terminal 6xHis-tagged
Expression Region	1-370aa
Protein length	Full Length
MW	45 kDa
Alternative Name(s)	Short name: HAOX1 Alternative name(s): Glycolate oxidase Short name: GOX
Relevance	Has 2-hydroxyacid oxidase activity. Most active on the 2-carbon substrate glycolate, but is also active on 2-hydroxy fatty acids, with high activity towards 2-hydroxy palmitate and 2-hydroxy octanoate (By similarity).
References	"SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways."Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013).
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Has 2-hydroxyacid oxidase activity. Most active on the 2-carbon substrate glycolate, but is also active on 2-hydroxy fatty acids, with high activity towards 2-hydroxy palmitate and 2-hydroxy octanoate (By similarity).
Subcellular Location	Peroxisome
Protein Families	FMN-dependent alpha-hydroxy acid dehydrogenase family
Tissue Specificity	Liver.
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen