« Zurück
Home /
Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 5(Adamts5)

Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 5(Adamts5)

ArtNr	CSB-EP889914MO-100
Hersteller	Cusabio
Menge	100ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Short name:,ADAM-TS 5,Short name:,ADAM-TS5,Short name:,ADAMTS-5,Alternative name(s):,ADMP-2,Aggrecanase-2,Implantin
Lieferbar
Research Areas	Signal Transduction
Uniprot ID	Q9R001
Gene Names	Adamts5
Organism	Mus musculus (Mouse)
AA Sequence	SISRARQVELLLVADSSMARMYGRGLQHYLLTLAS IANRLYSHASIENHIRLAVVKVVVLTDKDTSLEVS KNAATTLKNFCKWQHQHNQLGDDHEEHYDAAILFT REDLCGHHSCDTLGMADVGTICSPERSCAVIEDDG LHAAFTVAHEIGHLLGLSHDDSKFCEENFGTTEDK RLMSSILTSIDASKPWSKCTSATITEFLDDGHGNC LLDLPRKQILGPEELPGQTYDATQQCNLTFGPEYS VCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGTP CGKGRVCLQGKCVDKTKKKYYSTSSHGNWGSWGPW GQCSRSCGGGVQFAYRHCNNPAPRNSGRYCTGKRA IYRSCSVTPCPPNGKSFRHEQCEAKNGYQSDAKGV KTFVEWVPKYAGVLPADVCKLTCRAKGTGYYVVFS PKVTDGTECRPYSNSVCVRGRCVRTGCDGIIGSKL QYDKCGVCGGDNSSCTKIIGTFNKKSKGYTDVVRI PEGATHIKVRQFKAKDQTRFTAYLALKKKTGEYLI NGKYMISTSETIIDINGTVMNYSGWSHRDDFLHGM GYSATKEILIVQILATDPTKALDVRYSFFVPKKTT QKVNSVISHGSNKVGPHSTQLQWVTGPWLACSRTC DTGWHTRTVQCQDGNRKLAKGCLLSQRPSAFKQCL LKKC
Expression Region	262-930aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	77.8 kDa
Alternative Name(s)	Short name: ADAM-TS 5 Short name: ADAM-TS5 Short name: ADAMTS-5 Alternative name(s): ADMP-2 Aggrecanase-2 Implantin
Relevance	Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. May play a role in proteolytic processing mostly during the peri-implantation period.
Reference	The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Metalloproteinase that plays an important role in connective tissue organization, development, inflammation, arthritis, and cell migration. ADAMTS5 is an extracellular matrix (ECM) degrading enzyme that show proteolytic activity toward the hyalectan group of chondroitin sulfate proteoglycans (CSPGs) including aggrecan, versican, brevican and neurocan. Cleavage within the hyalectans occurs at Glu-Xaa recognition motifs. Plays a role in embryonic development, including limb and cardiac morphogenesis, and skeletal muscle development through its versican remodeling properties. Participates in the development of brown adipose tissue and browning of white adipose tissue
Subcellular Location	Secreted, extracellular space, extracellular matrix
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen