ArtNr |
CSB-EP889079HU-100 |
Hersteller |
Cusabio
|
Menge |
100ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
HMG box transcription factor 4,T-cell-specific transcription factor 4,Short name:,T-cell factor 4,Short name:,TCF-4,Short name:,hTCF-4 |
Lieferbar |
|
Research Areas |
Epigenetics and Nuclear Signaling |
Uniprot ID |
Q9NQB0 |
Gene Names |
TCF7L2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENS SAERDLADVKSSLVNESETNQNSSSDSEAERRPPP RSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPF IMIPDLTSPYLPNGSLSPTARTLHFQSGSTHYSAY KTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDA RSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEH FTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPL SPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPY PTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIV TPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHI KKPLNAFMLYMKEMRAKVVAECTLKESAAINQILG RRWHALSREEQAKYYELARKERQLHMQLYPGWSAR DNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPI |
Expression Region |
1-456aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
54.9 kDa |
Alternative Name(s) |
HMG box transcription factor 4 T-cell-specific transcription factor 4 Short name: T-cell factor 4 Short name: TCF-4 Short name: hTCF-4 |
Relevance |
Participates in the Wnt signaling pathway and modulates MYC expression by binding to its promoter in a sequence-specific manner. Acts as repressor in the absence of CTNNB1, and as activator in its presence. Activates transcription from promoters with several copies of the Tcf motif 5'-CCTTTGATC-3' in the presence of CTNNB1. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7L2/TCF4 and CTNNB1. Expression of dominant-negative mutants results in cell-cycle arrest in G1. Necessary for the maintenance of the epithelial stem-cell compartment of the small intestine. |
Reference |
Identification of c-MYC as a target of the APC pathway.He T.-C., Sparks A.B., Rago C., Hermeking H., Zawel L., da Costa L.T., Morin P.J., Vogelstein B., Kinzler K.W.Science 281:1509-1512(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Participates in the Wnt signaling pathway and modulates MYC expression by binding to its promoter in a sequence-specific manner. Acts as repressor in the absence of CTNNB1, and as activator in its presence. Activates transcription from promoters with several copies of the Tcf motif 5'-CCTTTGATC-3' in the presence of CTNNB1. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7L2/TCF4 and CTNNB1. Expression of dominant-negative mutants results in cell-cycle arrest in G1. Necessary for the maintenance of the epithelial stem-cell compartment of the small intestine. |
Involvement in disease |
Diabetes mellitus, non-insulin-dependent (NIDDM) |
Subcellular Location |
Nucleus, PML body |
Protein Families |
TCF/LEF family |
Tissue Specificity |
Detected in epithelium from small intestine, with the highest expression at the top of the crypts and a gradient of expression from crypt to villus. Detected in colon epithelium and colon cancer, and in epithelium from mammary gland and carcinomas derived therefrom. |
Paythway |
Hipposignalingpathway |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.