« Zurück
Home /
Recombinant Human FK506-binding protein-like(FKBPL)

Recombinant Human FK506-binding protein-like(FKBPL)

ArtNr	CSB-EP883441HU-200
Hersteller	Cusabio
Menge	200ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	WAF-1/CIP1 stabilizing protein 39
Lieferbar
Research Topic	Cell Biology
Uniprot ID	Q9UIM3
Gene Names	FKBPL
Organism	Homo sapiens (Human)
AA Sequence	METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQI RQQPRDPPTETLELEVSPDPASQILEHTQGAEKLV AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFV KKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEG WTELTMGVGPWREETWGELIEKCLESMCQGEEAEL QLPGHSGPPVRLTLASFTQGRDSWELETSEKEALA REERARGTELFRAGNPEGAARCYGRALRLLLTLPP PGPPERTVLHANLAACQLLLGQPQLAAQSCDRVLE REPGHLKALYRRGVAQAALGNLEKATADLKKVLAI DPKNRAAQEELGKVVIQGKNQDAGLAQGLRKMFG
Expression Region	1-349aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	65.2 kDa
Alternative Name(s)	WAF-1/CIP1 stabilizing protein 39
Relevance	May be involved in response to X-ray. Regulates p21 protein stability by binding to Hsp90 and p21.
Reference	"A novel human stress response-related gene with a potential role in induced radioresistance." Robson T., Joiner M.C., Wilson G.D., McCullough W., Price M.E., Logan I., Jones H., McKeown S.R., Hirst D.G. Radiat. Res. 152:451-461(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be involved in response to X-ray. Regulates p21 protein stability by binding to Hsp90 and p21.
Tissue Specificity	Ubiquitously expressed with higher levels in testis.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen