ArtNr |
CSB-EP880070HU-500 |
Hersteller |
Cusabio
|
Menge |
500ug |
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Konjugat/Tag |
GST |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
DARPP-32,Dopamine- and cAMP-regulated neuronal phosphoprotein |
Lieferbar |
|
Research Topic |
Neuroscience |
Uniprot ID |
Q9UD71 |
Gene Names |
PPP1R1B |
Organism |
Homo sapiens (Human) |
AA Sequence |
MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNP CAYTPPSLKAVQRIAESHLQSISNLNENQASEEED ELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEV LKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDG GSEDQVEDPALSEPGEEPQRPSPSEPGT |
Expression Region |
1-168aa |
Sequence Info |
Full Length of Isoform 2 |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
45.7 kDa |
Alternative Name(s) |
DARPP-32 Dopamine- and cAMP-regulated neuronal phosphoprotein |
Relevance |
Inhibitor of protein-phosphatase 1. |
Reference |
"Expression of mRNAs encoding ARPP-16/19, ARPP-21, and DARPP-32 in human brain tissue." Brene S., Lindefors N., Ehrlich M., Taubes T., Horiuchi A., Kopp J., Hall H., Sedvall G., Greengard P., Persson H. J. Neurosci. 14:985-998(1994) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Inhibitor of protein-phosphatase 1. |
Subcellular Location |
Cytoplasm |
Protein Families |
Protein phosphatase inhibitor 1 family |
Paythway |
cAMPsignalingpathway |
Tag Information |
N-terminal GST-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.