« Zurück
Home /
Recombinant Mouse UMP-CMP kinase(Cmpk1)

Recombinant Mouse UMP-CMP kinase(Cmpk1)

ArtNr	CSB-EP875274MO-1
Hersteller	Cusabio
Menge	1mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Deoxycytidylate kinaseU,Short name:,CK,Short name:,dCMP kinase,Nucleoside-diphosphate kinase,Uridine monophosphate/cytidine monophosphate kinase,Short name:,UMP/CMP kinase,Short name:,UMP/CMP
Lieferbar
Research Areas	Epigenetics and Nuclear Signaling
Uniprot ID	Q9DBP5
Gene Names	Cmpk1
Organism	Mus musculus (Mouse)
AA Sequence	MKPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAG ELLRDERKNPDSQYGELIEKYIKEGKIVPVEITIS LLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWN KTMDGKADVSFVLFFDCNNEICIERCLERGKSSGR SDDNRESLEKRIQTYLESTKPIIDLYEEMGKVKKI DASKSVDEVFGEVVKIFDKEG
Expression Region	1-196aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	26.2 kDa
Alternative Name(s)	Deoxycytidylate kinaseU Short name: CK Short name: dCMP kinase Nucleoside-diphosphate kinase Uridine monophosphate/cytidine monophosphate kinase Short name: UMP/CMP kinase Short name: UMP/CMP
Relevance	Catalyzes the phosphorylation of pyrimidine nucleoside monophosphates at the expense of ATP. Plays an important role in de novo pyrimidine nucleotide biosynthesis. Has preference for UMP and CMP as phosphate acceptors. Also displays broad nucleoside diphosphate kinase activity.
Reference	Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the phosphorylation of pyrimidine nucleoside monophosphates at the expense of ATP. Plays an important role in de novo pyrimidine nucleotide biosynthesis. Has preference for UMP and CMP as phosphate acceptors. Also displays broad nucleoside diphosphate kinase activity.
Subcellular Location	Nucleus, Cytoplasm
Protein Families	Adenylate kinase family, UMP-CMP kinase subfamily
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP875274MO-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen